Pay in 4 interest-free payments of $6.18 Learn more
Ships within 48 hours · Estimated delivery Aug 9 - Aug 14
Comparing the efficacy of liraglutide 1.2 mg/day vs metformin 1000 mg BID (twice daily), Jensterle et al
-20C, 1 month (sealed storage, away from moisture) Biological Activity Chemical Information Appearance Solid Molecular Weight 3089.41 (free base) Formula C 140 H 214 N 36 O 43 .xC 2 HF 3 O 2 Color White to off-white Sequence Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 Shipping Room temperature in continental US
They are generally smaller molecules with broader mechanisms of action
Because a microdose keeps the dose low and steady rather than escalating it, many people find the experience gentler than a standard ramp-up, though responses are individual
Hum Reprod (2001) 16(11):228894
US$ 26.69
US$ 24.01
US$ 27.00
US$ 26.71
